Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Human (Homo sapiens), HLA-B*3501 [TaxId:9606] [48953] (3 PDB entries) |
Domain d1a9be1: 1a9b E: [20762] Other proteins in same PDB: d1a9ba2, d1a9bd2 |
PDB Entry: 1a9b (more details), 3.2 Å
SCOP Domain Sequences for d1a9be1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9be1 b.1.1.2 (E:) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B*3501} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1a9be1: