SCOP 1.73: Domain d1a9bd1: 1a9b D:182-277

Lineage for d1a9bd1 (1a9b D:182-277)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d1a9bd1: 1a9b D:182-277 [20761]
   Other proteins in same PDB: d1a9ba2, d1a9bb_, d1a9bd2, d1a9be_

Details for d1a9bd1

PDB Entry: 1a9b, 3.2 Å

PDB Description: decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus

PDB Compounds: (D:) hla class I histocompatibility antigen, b-35 b*3501 (alpha chain)

SCOP Domain Sequences for d1a9bd1:

Sequence; same for both SEQRES and ATOM records:

>d1a9bd1 b.1.1.2 (D:182-277) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrweps

Timeline for d1a9bd1:

• d1a9bd1 first appeared (with stable ids) in SCOP 1.55
  
• d1a9bd1 appears in SCOP 1.71
  
• d1a9bd1 appears in SCOP 1.75
  
• d1a9bd1 appears in the current release, SCOPe 2.08