Lineage for d1a9bd1 (1a9b D:182-277)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364613Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)
  8. 364698Domain d1a9bd1: 1a9b D:182-277 [20761]
    Other proteins in same PDB: d1a9ba2, d1a9bb_, d1a9bd2, d1a9be_

Details for d1a9bd1

PDB Entry: 1a9b (more details), 3.2 Å

PDB Description: decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus

SCOP Domain Sequences for d1a9bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9bd1 b.1.1.2 (D:182-277) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrweps

SCOP Domain Coordinates for d1a9bd1:

Click to download the PDB-style file with coordinates for d1a9bd1.
(The format of our PDB-style files is described here.)

Timeline for d1a9bd1: