SCOPe 2.03: Domain d2yhed2: 2yhe D:539-663

Lineage for d2yhed2 (2yhe D:539-663)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.0: automated matches [191568] (1 protein)
   not a true family

6. Protein automated matches [190987] (3 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:1007495] [226383] (2 PDB entries)

8. Domain d2yhed2: 2yhe D:539-663 [207598]
   Other proteins in same PDB: d2yhea1, d2yheb1, d2yhec1, d2yhed1, d2yhee1, d2yhef1
   automated match to d2cfua1
   complexed with so4, zn

Details for d2yhed2

PDB Entry: 2yhe, 2.7 Å

PDB Description: structure determination of the stereoselective inverting sec- alkylsulfatase pisa1 from pseudomonas sp.

PDB Compounds: (D:) sec-alkyl sulfatase

SCOPe Domain Sequences for d2yhed2:

Sequence; same for both SEQRES and ATOM records:

>d2yhed2 d.106.1.0 (D:539-663) automated matches {Pseudomonas sp. [TaxId: 1007495]}
gksemgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgs
lnpkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfni
veleh

Timeline for d2yhed2:

• d2yhed2 is new in SCOPe 2.03-stable
  
• d2yhed2 appears in SCOPe 2.04
  
• d2yhed2 appears in the current release, SCOPe 2.08