Lineage for d2yhed1 (2yhe D:30-538)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440394Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1440395Protein automated matches [190418] (8 species)
    not a true protein
  7. 1440464Species Pseudomonas sp. [TaxId:1007495] [226382] (2 PDB entries)
  8. 1440468Domain d2yhed1: 2yhe D:30-538 [207597]
    Other proteins in same PDB: d2yhea2, d2yheb2, d2yhec2, d2yhed2, d2yhee2, d2yhef2
    automated match to d2cfua2
    complexed with so4, zn

Details for d2yhed1

PDB Entry: 2yhe (more details), 2.7 Å

PDB Description: structure determination of the stereoselective inverting sec- alkylsulfatase pisa1 from pseudomonas sp.
PDB Compounds: (D:) sec-alkyl sulfatase

SCOPe Domain Sequences for d2yhed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yhed1 d.157.1.0 (D:30-538) automated matches {Pseudomonas sp. [TaxId: 1007495]}
esldskpasaitaaknaevlknlpfadreefeaakrgliapfsgqiknaegqvvwdmgay
qflndkdaadtvnpslwrqaqlnniaglfevmpklyqvrgldpanmtiiegdsglvlidt
lttaetaraaldlyfqhrpkkpivavvyshshidhfggargiideadvkagkvkvfapsg
fmehavsenilagtamarrgqyqsgvmvprgaqaqvdsglfkttatnatntlvapnvlie
kpyerhtvdgvelefqltlgseapsdmniylpqfkvlntadnappamhnlltprgaevrd
akawagyidaslekygdrtdvliqqhnwpvwggdkvrtyladqrdmyaflnnralnlmnk
gltlheiaaevsklpgeldrkwylrsyygalstnlravyqrylgfydgnpanldpfppve
agkryveamggadavlkqmraaidkgdyrwavqlgnhlvfadpankdaralqadameqlg
yqtenalwrnmymtgamelrhgvptydsr

SCOPe Domain Coordinates for d2yhed1:

Click to download the PDB-style file with coordinates for d2yhed1.
(The format of our PDB-style files is described here.)

Timeline for d2yhed1: