Lineage for d2ygxd_ (2ygx D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (68 species)
    not a true protein
  7. 2331924Species Micromonospora griseorubida [TaxId:28040] [226290] (10 PDB entries)
  8. 2331943Domain d2ygxd_: 2ygx D: [207586]
    automated match to d3e5la_
    complexed with gol, hem, sin

Details for d2ygxd_

PDB Entry: 2ygx (more details), 2.39 Å

PDB Description: Structure of the mixed-function P450 MycG in P21 space group
PDB Compounds: (D:) p-450-like protein

SCOPe Domain Sequences for d2ygxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ygxd_ a.104.1.0 (D:) automated matches {Micromonospora griseorubida [TaxId: 28040]}
epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
qrlpgirlgipetqlrwsegmllrgplelpvvw

SCOPe Domain Coordinates for d2ygxd_:

Click to download the PDB-style file with coordinates for d2ygxd_.
(The format of our PDB-style files is described here.)

Timeline for d2ygxd_: