![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Micromonospora griseorubida [TaxId:28040] [226290] (10 PDB entries) |
![]() | Domain d2ygxa_: 2ygx A: [207583] automated match to d3e5la_ complexed with gol, hem, sin |
PDB Entry: 2ygx (more details), 2.39 Å
SCOPe Domain Sequences for d2ygxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ygxa_ a.104.1.0 (A:) automated matches {Micromonospora griseorubida [TaxId: 28040]} epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll qrlpgirlgipetqlrwsegmllrgplelpvvw
Timeline for d2ygxa_: