Lineage for d2yfwg_ (2yfw G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 2310745Protein automated matches [193445] (6 species)
    not a true protein
  7. 2310991Species Kluyveromyces lactis [TaxId:284590] [226140] (2 PDB entries)
  8. 2310999Domain d2yfwg_: 2yfw G: [207580]
    automated match to d2hioc_

Details for d2yfwg_

PDB Entry: 2yfw (more details), 2.6 Å

PDB Description: heterotetramer structure of kluyveromyces lactis cse4,h4
PDB Compounds: (G:) histone h3-like centromeric protein cse4

SCOPe Domain Sequences for d2yfwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfwg_ a.22.1.1 (G:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
tdllisrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgllehtnllalha
kritimrkdmqlarrirg

SCOPe Domain Coordinates for d2yfwg_:

Click to download the PDB-style file with coordinates for d2yfwg_.
(The format of our PDB-style files is described here.)

Timeline for d2yfwg_: