SCOPe 2.05: Domain d2yfwf_: 2yfw F:

Lineage for d2yfwf_ (2yfw F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species Kluyveromyces lactis [TaxId:284590] [226140] (2 PDB entries)

8. Domain d2yfwf_: 2yfw F: [207579]
   automated match to d1id3f_

Details for d2yfwf_

PDB Entry: 2yfw, 2.6 Å

PDB Description: heterotetramer structure of kluyveromyces lactis cse4,h4

PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d2yfwf_:

Sequence; same for both SEQRES and ATOM records:

>d2yfwf_ a.22.1.1 (F:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
rdniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvt
sldvvyalkrqg

Timeline for d2yfwf_:

• d2yfwf_ first appeared in SCOPe 2.03
  
• d2yfwf_ appears in SCOPe 2.04
  
• d2yfwf_ appears in SCOPe 2.06
  
• d2yfwf_ appears in the current release, SCOPe 2.08