![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species Kluyveromyces lactis [TaxId:284590] [226140] (3 PDB entries) |
![]() | Domain d2yfwe_: 2yfw E: [207578] automated match to d2hioc_ |
PDB Entry: 2yfw (more details), 2.6 Å
SCOPe Domain Sequences for d2yfwe_:
Sequence, based on SEQRES records: (download)
>d2yfwe_ a.22.1.1 (E:) automated matches {Kluyveromyces lactis [TaxId: 284590]} alaeirkyqrstdllisrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgl lehtnllalhakritimrkdmqlarrirgqfi
>d2yfwe_ a.22.1.1 (E:) automated matches {Kluyveromyces lactis [TaxId: 284590]} alaeirkyqrstdllisrmpfarlvkevtdqftplrwqsmaimalqeaseaylvglleht nllalhakritimrkdmqlarrirgqfi
Timeline for d2yfwe_: