| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (8 species) not a true protein |
| Species Kluyveromyces lactis [TaxId:284590] [226140] (3 PDB entries) |
| Domain d2yfwd_: 2yfw D: [207577] automated match to d1id3f_ |
PDB Entry: 2yfw (more details), 2.6 Å
SCOPe Domain Sequences for d2yfwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfwd_ a.22.1.1 (D:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvts
ldvvyalkrqg
Timeline for d2yfwd_: