Lineage for d2yfwb_ (2yfw B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987741Protein automated matches [193445] (6 species)
    not a true protein
  7. 1987987Species Kluyveromyces lactis [TaxId:284590] [226140] (2 PDB entries)
  8. 1987990Domain d2yfwb_: 2yfw B: [207575]
    automated match to d1id3f_

Details for d2yfwb_

PDB Entry: 2yfw (more details), 2.6 Å

PDB Description: heterotetramer structure of kluyveromyces lactis cse4,h4
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d2yfwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfwb_ a.22.1.1 (B:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
itkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvtsldvvy
alkrqg

SCOPe Domain Coordinates for d2yfwb_:

Click to download the PDB-style file with coordinates for d2yfwb_.
(The format of our PDB-style files is described here.)

Timeline for d2yfwb_: