Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (6 species) not a true protein |
Species Kluyveromyces lactis [TaxId:284590] [226140] (2 PDB entries) |
Domain d2yfwb_: 2yfw B: [207575] automated match to d1id3f_ |
PDB Entry: 2yfw (more details), 2.6 Å
SCOPe Domain Sequences for d2yfwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfwb_ a.22.1.1 (B:) automated matches {Kluyveromyces lactis [TaxId: 284590]} itkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvtsldvvy alkrqg
Timeline for d2yfwb_: