SCOPe 2.07: Domain d2yfwa_: 2yfw A:

Lineage for d2yfwa_ (2yfw A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Kluyveromyces lactis [TaxId:284590] [226140] (3 PDB entries)

8. Domain d2yfwa_: 2yfw A: [207574]
   automated match to d2hioc_

Details for d2yfwa_

PDB Entry: 2yfw, 2.6 Å

PDB Description: heterotetramer structure of kluyveromyces lactis cse4,h4

PDB Compounds: (A:) histone h3-like centromeric protein cse4

SCOPe Domain Sequences for d2yfwa_:

Sequence, based on SEQRES records:

>d2yfwa_ a.22.1.1 (A:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dllisrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgllehtnllalhak
ritimrkdmqlarrirgqf

Sequence, based on observed residues (ATOM records):

>d2yfwa_ a.22.1.1 (A:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dllisrmpfarlvkevtdqftteeplrwqsmaimalqeaseaylvgllehtnllalhakr
itimrkdmqlarrirgqf

Timeline for d2yfwa_:

• d2yfwa_ first appeared in SCOPe 2.03
  
• d2yfwa_ appears in SCOPe 2.06
  
• d2yfwa_ appears in the current release, SCOPe 2.08