SCOPe 2.06: Domain d2yfqb1: 2yfq B:5-180

Lineage for d2yfqb1 (2yfq B:5-180)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (29 species)
   not a true protein

7. Species Peptoniphilus asaccharolyticus [TaxId:1258] [226258] (1 PDB entry)

8. Domain d2yfqb1: 2yfq B:5-180 [207572]
   Other proteins in same PDB: d2yfqa2, d2yfqb2
   automated match to d1euza2
   complexed with so4

Details for d2yfqb1

PDB Entry: 2yfq, 2.94 Å

PDB Description: Crystal structure of Glutamate dehydrogenase from Peptoniphilus asaccharolyticus

PDB Compounds: (B:) nad-specific glutamate dehydrogenase

SCOPe Domain Sequences for d2yfqb1:

Sequence; same for both SEQRES and ATOM records:

>d2yfqb1 c.58.1.0 (B:5-180) automated matches {Peptoniphilus asaccharolyticus [TaxId: 1258]}
lnplvaaqekvriaceklgcdpavyellkepqrvieisipvkmddgtvkvfkgwrsahss
avgpskggvrfhpnvnmdevkalslwmtfkggalglpygggkggicvdpaelsereleql
srgwvrglykylgdridipapdvntngqimswfvdeyvklngermdigtftgkpva

Timeline for d2yfqb1:

• d2yfqb1 first appeared in SCOPe 2.03
  
• d2yfqb1 appears in SCOPe 2.05
  
• d2yfqb1 appears in SCOPe 2.07
  
• d2yfqb1 appears in the current release, SCOPe 2.08