Lineage for d2yf1a1 (2yf1 A:1-177)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1642705Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1642706Protein automated matches [226842] (4 species)
    not a true protein
  7. 1642707Species Chicken (Gallus gallus) [TaxId:9031] [225828] (8 PDB entries)
  8. 1642713Domain d2yf1a1: 2yf1 A:1-177 [207567]
    Other proteins in same PDB: d2yf1a2, d2yf1b_
    automated match to d1de4a2
    complexed with ca, edo

Details for d2yf1a1

PDB Entry: 2yf1 (more details), 2.75 Å

PDB Description: complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
PDB Compounds: (A:) Major histocompatibility complex class I glycoprotein haplotype B21

SCOPe Domain Sequences for d2yf1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yf1a1 d.19.1.0 (A:1-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elhtlryirtamtdpgpglpwfvdvgyvdgelfmhynstarravprtewiaantdqqywd
retqivqgseqinrenldilrrrynqtggshtvqwmsgcdiledgtirgyhqaaydgrdf
vafdkgtmtltaavpeavptkrkweeggyaeglkqyleetcvewlrryveygkaelg

SCOPe Domain Coordinates for d2yf1a1:

Click to download the PDB-style file with coordinates for d2yf1a1.
(The format of our PDB-style files is described here.)

Timeline for d2yf1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yf1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2yf1b_