| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (5 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries) |
| Domain d2yf1a1: 2yf1 A:1-177 [207567] Other proteins in same PDB: d2yf1a2, d2yf1b_ automated match to d1de4a2 complexed with ca, edo |
PDB Entry: 2yf1 (more details), 2.75 Å
SCOPe Domain Sequences for d2yf1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yf1a1 d.19.1.0 (A:1-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elhtlryirtamtdpgpglpwfvdvgyvdgelfmhynstarravprtewiaantdqqywd
retqivqgseqinrenldilrrrynqtggshtvqwmsgcdiledgtirgyhqaaydgrdf
vafdkgtmtltaavpeavptkrkweeggyaeglkqyleetcvewlrryveygkaelg
Timeline for d2yf1a1: