SCOPe 2.08: Domain d2yeza2: 2yez A:178-270

Lineage for d2yeza2 (2yez A:178-270)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)

8. Domain d2yeza2: 2yez A:178-270 [207565]
   Other proteins in same PDB: d2yeza1, d2yeza3
   automated match to d1de4a1

Details for d2yeza2

PDB Entry: 2yez, 2.9 Å

PDB Description: complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide

PDB Compounds: (A:) Major histocompatibility complex class I glycoprotein haplotype B21

SCOPe Domain Sequences for d2yeza2:

Sequence; same for both SEQRES and ATOM records:

>d2yeza2 b.1.1.0 (A:178-270) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rrerpevrvwgkeadgiltlscrahgfyprpivvswlkdgavrgqdaqsggivpngdgty
htwvtidaqpgdgdkyqcrvehaslpqpglysw

Timeline for d2yeza2:

• d2yeza2 first appeared in SCOPe 2.03
  
• d2yeza2 appears in SCOPe 2.07