Lineage for d2yeza1 (2yez A:1-177)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938653Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries)
  8. 2938670Domain d2yeza1: 2yez A:1-177 [207564]
    Other proteins in same PDB: d2yeza2, d2yeza3, d2yezb_
    automated match to d1de4a2

Details for d2yeza1

PDB Entry: 2yez (more details), 2.9 Å

PDB Description: complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
PDB Compounds: (A:) Major histocompatibility complex class I glycoprotein haplotype B21

SCOPe Domain Sequences for d2yeza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yeza1 d.19.1.0 (A:1-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elhtlryirtamtdpgpglpwfvdvgyvdgelfmhynstarravprtewiaantdqqywd
retqivqgseqinrenldilrrrynqtggshtvqwmsgcdiledgtirgyhqaaydgrdf
vafdkgtmtltaavpeavptkrkweeggyaeglkqyleetcvewlrryveygkaelg

SCOPe Domain Coordinates for d2yeza1:

Click to download the PDB-style file with coordinates for d2yeza1.
(The format of our PDB-style files is described here.)

Timeline for d2yeza1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yezb_