SCOPe 2.05: Domain d2yekc_: 2yek C:

Lineage for d2yekc_ (2yek C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d2yekc_: 2yek C: [207563]
   automated match to d3zyub_
   complexed with eam, so4

Details for d2yekc_

PDB Entry: 2yek, 1.98 Å

PDB Description: Crystal Structure of the First Bromodomain of Human Brd2 with the inhibitor GSK525762 (IBET)

PDB Compounds: (C:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d2yekc_:

Sequence; same for both SEQRES and ATOM records:

>d2yekc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyy
waasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmp

Timeline for d2yekc_:

• d2yekc_ first appeared in SCOPe 2.03
  
• d2yekc_ appears in SCOPe 2.04
  
• d2yekc_ appears in SCOPe 2.06
  
• d2yekc_ appears in the current release, SCOPe 2.08