Lineage for d2yekc_ (2yek C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1487795Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)
  8. 1487919Domain d2yekc_: 2yek C: [207563]
    automated match to d3zyub_
    complexed with eam, so4

Details for d2yekc_

PDB Entry: 2yek (more details), 1.98 Å

PDB Description: Crystal Structure of the First Bromodomain of Human Brd2 with the inhibitor GSK525762 (IBET)
PDB Compounds: (C:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d2yekc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yekc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyy
waasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmp

SCOPe Domain Coordinates for d2yekc_:

Click to download the PDB-style file with coordinates for d2yekc_.
(The format of our PDB-style files is described here.)

Timeline for d2yekc_: