SCOPe 2.05: Domain d2ydia_: 2ydi A:

Lineage for d2ydia_ (2ydi A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)

8. Domain d2ydia_: 2ydi A: [207556]
   automated match to d2x8da_
   complexed with so4, ydi

Details for d2ydia_

PDB Entry: 2ydi, 1.6 Å

PDB Description: discovery of checkpoint kinase inhibitor azd7762 by structure based design and optimization of thiophene carboxamide ureas

PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d2ydia_:

Sequence; same for both SEQRES and ATOM records:

>d2ydia_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplkkgakrprvtsg

Timeline for d2ydia_:

• d2ydia_ first appeared in SCOPe 2.03
  
• d2ydia_ appears in SCOPe 2.04
  
• d2ydia_ appears in SCOPe 2.06
  
• d2ydia_ appears in the current release, SCOPe 2.08