Lineage for d2ydfa3 (2ydf A:389-582)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1748371Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1748372Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1748373Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1748374Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 1748375Species Human (Homo sapiens) [TaxId:9606] [48555] (70 PDB entries)
    Uniprot P02768 29-596
  8. 1748471Domain d2ydfa3: 2ydf A:389-582 [207551]
    automated match to d1n5ua3
    complexed with io3

Details for d2ydfa3

PDB Entry: 2ydf (more details), 2.75 Å

PDB Description: human serum albumin complexed with iophenoxic acid
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2ydfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ydfa3 a.126.1.1 (A:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

SCOPe Domain Coordinates for d2ydfa3:

Click to download the PDB-style file with coordinates for d2ydfa3.
(The format of our PDB-style files is described here.)

Timeline for d2ydfa3: