Lineage for d2ydba_ (2ydb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956563Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2956564Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2956578Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins)
    automatically mapped to Pfam PF05881
  6. 2956583Protein automated matches [190813] (2 species)
    not a true protein
  7. 2956586Species Mouse (Mus musculus) [TaxId:10090] [189888] (31 PDB entries)
  8. 2956612Domain d2ydba_: 2ydb A: [207547]
    automated match to d2y3xb_
    complexed with nap

Details for d2ydba_

PDB Entry: 2ydb (more details), 2.15 Å

PDB Description: catalytic domain of mouse 2',3'-cyclic nucleotide 3'- phosphodiesterase, soaked with 2',3'-cyclic nadp
PDB Compounds: (A:) 2', 3'-cyclic nucleotide 3'-phosphodiesterase

SCOPe Domain Sequences for d2ydba_:

Sequence, based on SEQRES records: (download)

>d2ydba_ d.61.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkeklelvsyfg
krppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvlt
dqelqlwpsdldkpsaseglppgsrahvtlgcaadvqpvqtgldlldilqqvkggsqgea
vgelprgklyslgkgrwmlsltkkmevkaiftgyyg

Sequence, based on observed residues (ATOM records): (download)

>d2ydba_ d.61.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgkeklelvsyfgkrp
pgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvltdqe
lqlwpsdldkpsaseglppgsrahvtlgcaadvqpvqtgldlldilqqvkggsqgeavge
lprgklyslgkgrwmlsltkkmevkaiftgyyg

SCOPe Domain Coordinates for d2ydba_:

Click to download the PDB-style file with coordinates for d2ydba_.
(The format of our PDB-style files is described here.)

Timeline for d2ydba_: