Lineage for d2ycaa_ (2yca A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005702Species Micromonospora griseorubida [TaxId:28040] [226290] (10 PDB entries)
  8. 2005706Domain d2ycaa_: 2yca A: [207546]
    automated match to d3e5la_
    complexed with gol, hem, sin, zm3

Details for d2ycaa_

PDB Entry: 2yca (more details), 1.8 Å

PDB Description: Mixed-function P450 MycG in complex with mycinamicin III in P21212 space group
PDB Compounds: (A:) p-450-like protein

SCOPe Domain Sequences for d2ycaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ycaa_ a.104.1.0 (A:) automated matches {Micromonospora griseorubida [TaxId: 28040]}
epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
qrlpgirlgipetqlrwsegmllrgplelpvvw

SCOPe Domain Coordinates for d2ycaa_:

Click to download the PDB-style file with coordinates for d2ycaa_.
(The format of our PDB-style files is described here.)

Timeline for d2ycaa_: