Lineage for d2ybvp_ (2ybv P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957834Protein automated matches [190066] (7 species)
    not a true protein
  7. 2957940Species Thermosynechococcus elongatus [TaxId:197221] [193543] (2 PDB entries)
  8. 2957948Domain d2ybvp_: 2ybv P: [207544]
    Other proteins in same PDB: d2ybva1, d2ybva2, d2ybvc1, d2ybvc2, d2ybve1, d2ybve2, d2ybvg1, d2ybvg2, d2ybvi1, d2ybvi2, d2ybvk1, d2ybvk2, d2ybvm1, d2ybvm2, d2ybvo1, d2ybvo2
    automated match to d3zxwd_
    complexed with cl

Details for d2ybvp_

PDB Entry: 2ybv (more details), 2.3 Å

PDB Description: structure of rubisco from thermosynechococcus elongatus
PDB Compounds: (P:) ribulose bisphosphate carboxylase small subunit

SCOPe Domain Sequences for d2ybvp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ybvp_ d.73.1.1 (P:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp

SCOPe Domain Coordinates for d2ybvp_:

Click to download the PDB-style file with coordinates for d2ybvp_.
(The format of our PDB-style files is described here.)

Timeline for d2ybvp_: