Lineage for d2ybvi2 (2ybv I:151-459)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088660Protein automated matches [226984] (9 species)
    not a true protein
  7. 2088760Species Thermosynechococcus elongatus [TaxId:197221] [226344] (2 PDB entries)
  8. 2088769Domain d2ybvi2: 2ybv I:151-459 [207534]
    Other proteins in same PDB: d2ybva1, d2ybvb_, d2ybvc1, d2ybvd_, d2ybve1, d2ybvf_, d2ybvg1, d2ybvh_, d2ybvi1, d2ybvj_, d2ybvk1, d2ybvl_, d2ybvm1, d2ybvn_, d2ybvo1, d2ybvp_
    automated match to d1wdda1
    complexed with cl

Details for d2ybvi2

PDB Entry: 2ybv (more details), 2.3 Å

PDB Description: structure of rubisco from thermosynechococcus elongatus
PDB Compounds: (I:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2ybvi2:

Sequence, based on SEQRES records: (download)

>d2ybvi2 c.1.14.1 (I:151-459) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
pphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddeninsqp
fqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimhdfl
tagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhihtgt
vvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhmpal
vdifgddavlqfgggtlghpwgnapgatanrvaleaciqarnegrdlmreggdiireaar
wspelaaac

Sequence, based on observed residues (ATOM records): (download)

>d2ybvi2 c.1.14.1 (I:151-459) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
pphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddeninsqp
fqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimhdfl
tagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhihtgt
vvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhmpal
vdifgddavlqfgghpwgnapgatanrvaleaciqarnegrdlmreggdiireaarwspe
laaac

SCOPe Domain Coordinates for d2ybvi2:

Click to download the PDB-style file with coordinates for d2ybvi2.
(The format of our PDB-style files is described here.)

Timeline for d2ybvi2: