![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries) |
![]() | Domain d1a1ma1: 1a1m A:182-278 [20753] Other proteins in same PDB: d1a1ma2, d1a1mb_ |
PDB Entry: 1a1m (more details), 2.3 Å
SCOP Domain Sequences for d1a1ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a1ma1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Human (Homo sapiens)} adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf qkwaavvvpsgeeqrytchvqheglpkpltlrwephh
Timeline for d1a1ma1: