SCOPe 2.06: Domain d2ybvc1: 2ybv C:23-150

Lineage for d2ybvc1 (2ybv C:23-150)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (18 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [226343] (2 PDB entries)

8. Domain d2ybvc1: 2ybv C:23-150 [207524]
   Other proteins in same PDB: d2ybva2, d2ybvb_, d2ybvc2, d2ybvd_, d2ybve2, d2ybvf_, d2ybvg2, d2ybvh_, d2ybvi2, d2ybvj_, d2ybvk2, d2ybvl_, d2ybvm2, d2ybvn_, d2ybvo2, d2ybvp_
   automated match to d1wdda2
   complexed with cl

Details for d2ybvc1

PDB Entry: 2ybv, 2.3 Å

PDB Description: structure of rubisco from thermosynechococcus elongatus

PDB Compounds: (C:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2ybvc1:

Sequence, based on SEQRES records:

>d2ybvc1 d.58.9.0 (C:23-150) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwtdlltdldrykg
ccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripv
aylktfqg

Sequence, based on observed residues (ATOM records):

>d2ybvc1 d.58.9.0 (C:23-150) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
fqg

Timeline for d2ybvc1:

• d2ybvc1 first appeared in SCOPe 2.03
  
• d2ybvc1 appears in SCOPe 2.05
  
• d2ybvc1 appears in SCOPe 2.07
  
• d2ybvc1 appears in the current release, SCOPe 2.08