Lineage for d2yawc_ (2yaw C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950003Family d.58.4.17: SOR-like [143278] (2 proteins)
    Pfam PF07682; duplication: consists of two similar domains
  6. 2950007Protein automated matches [190550] (3 species)
    not a true protein
  7. 2950008Species Acidianus ambivalens [TaxId:2283] [187530] (10 PDB entries)
  8. 2950060Domain d2yawc_: 2yaw C: [207511]
    automated match to d2yaxc_
    complexed with act, fe, hg

Details for d2yawc_

PDB Entry: 2yaw (more details), 2.5 Å

PDB Description: hg inhibited sulfur oxygenase reductase
PDB Compounds: (C:) Sulfur oxygenase/reductase

SCOPe Domain Sequences for d2yawc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yawc_ d.58.4.17 (C:) automated matches {Acidianus ambivalens [TaxId: 2283]}
pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
wreylne

SCOPe Domain Coordinates for d2yawc_:

Click to download the PDB-style file with coordinates for d2yawc_.
(The format of our PDB-style files is described here.)

Timeline for d2yawc_: