Lineage for d1a1oa1 (1a1o A:182-276)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 53049Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [48952] (2 PDB entries)
  8. 53050Domain d1a1oa1: 1a1o A:182-276 [20751]
    Other proteins in same PDB: d1a1oa2

Details for d1a1oa1

PDB Entry: 1a1o (more details), 2.3 Å

PDB Description: mhc class i molecule b*5301 complexed with peptide ls6 (kpivqydnf) from the malaria parasite p. falciparum

SCOP Domain Sequences for d1a1oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1oa1 b.1.1.2 (A:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B53}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1a1oa1:

Click to download the PDB-style file with coordinates for d1a1oa1.
(The format of our PDB-style files is described here.)

Timeline for d1a1oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a1oa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1a1ob1