Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
Protein automated matches [190120] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226239] (1 PDB entry) |
Domain d2y9ma1: 2y9m A:15-179 [207502] Other proteins in same PDB: d2y9ma2 automated match to d1x23d_ complexed with edo |
PDB Entry: 2y9m (more details), 2.6 Å
SCOPe Domain Sequences for d2y9ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y9ma1 d.20.1.0 (A:15-179) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} adtcmsrivkeykvilktlasddpianpyrgiieslnpidetdlskweaiisgpsdtpye nhqfrilievpssypmnppkisfmqnnilhcnvksatgeiclnilkpeewtpvwdllhcv havwrllrepvcdspldvdigniircgdmsayqgivkyflaerer
Timeline for d2y9ma1: