Lineage for d2y9ma_ (2y9m A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898682Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1898683Protein automated matches [190120] (6 species)
    not a true protein
  7. 1898684Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226239] (1 PDB entry)
  8. 1898685Domain d2y9ma_: 2y9m A: [207502]
    automated match to d1x23d_
    complexed with edo

Details for d2y9ma_

PDB Entry: 2y9m (more details), 2.6 Å

PDB Description: pex4p-pex22p structure
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-21 kda

SCOPe Domain Sequences for d2y9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y9ma_ d.20.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
madtcmsrivkeykvilktlasddpianpyrgiieslnpidetdlskweaiisgpsdtpy
enhqfrilievpssypmnppkisfmqnnilhcnvksatgeiclnilkpeewtpvwdllhc
vhavwrllrepvcdspldvdigniircgdmsayqgivkyflaerer

SCOPe Domain Coordinates for d2y9ma_:

Click to download the PDB-style file with coordinates for d2y9ma_.
(The format of our PDB-style files is described here.)

Timeline for d2y9ma_: