![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
![]() | Species Human (Homo sapiens), HLA-B0801 [TaxId:9606] [48951] (5 PDB entries) |
![]() | Domain d1ageb1: 1age B: [20750] Other proteins in same PDB: d1agea2 |
PDB Entry: 1age (more details), 2.3 Å
SCOP Domain Sequences for d1ageb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ageb1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B0801} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1ageb1: