Lineage for d2y7kd_ (2y7k D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879927Protein automated matches [190140] (18 species)
    not a true protein
  7. 1879941Species Burkholderia sp. [TaxId:233098] [190010] (5 PDB entries)
  8. 1879946Domain d2y7kd_: 2y7k D: [207496]
    automated match to d2y7pa_
    complexed with sal

Details for d2y7kd_

PDB Entry: 2y7k (more details), 1.95 Å

PDB Description: dntr inducer binding domain in complex with salicylate. monoclinic crystal form
PDB Compounds: (D:) LysR-type regulatory protein

SCOPe Domain Sequences for d2y7kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y7kd_ c.94.1.1 (D:) automated matches {Burkholderia sp. [TaxId: 233098]}
dpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdla
lgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgevd
glleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpd
iainlfwhakynrdpgnmwlrqlfvelfs

SCOPe Domain Coordinates for d2y7kd_:

Click to download the PDB-style file with coordinates for d2y7kd_.
(The format of our PDB-style files is described here.)

Timeline for d2y7kd_: