SCOPe 2.08: Domain d2y7kb1: 2y7k B:91-301

Lineage for d2y7kb1 (2y7k B:91-301)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Burkholderia sp. [TaxId:233098] [190010] (5 PDB entries)

8. Domain d2y7kb1: 2y7k B:91-301 [207494]
   Other proteins in same PDB: d2y7kb2, d2y7kc2
   automated match to d2y7pa_
   complexed with sal

Details for d2y7kb1

PDB Entry: 2y7k, 1.95 Å

PDB Description: dntr inducer binding domain in complex with salicylate. monoclinic crystal form

PDB Compounds: (B:) LysR-type regulatory protein

SCOPe Domain Sequences for d2y7kb1:

Sequence; same for both SEQRES and ATOM records:

>d2y7kb1 c.94.1.1 (B:91-301) automated matches {Burkholderia sp. [TaxId: 233098]}
dpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdla
lgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgevd
glleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpd
iainlfwhakynrdpgnmwlrqlfvelfsea

Timeline for d2y7kb1:

• d2y7kb1 first appeared in SCOPe 2.03, called d2y7kb_
  
• d2y7kb1 appears in SCOPe 2.07