SCOPe 2.07: Domain d2y78a1: 2y78 A:1-113

Lineage for d2y78a1 (2y78 A:1-113)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:272560] [226139] (3 PDB entries)

8. Domain d2y78a1: 2y78 A:1-113 [207492]
   Other proteins in same PDB: d2y78a2
   automated match to d4dz3b_
   complexed with cl, gol, so4

Details for d2y78a1

PDB Entry: 2y78, 0.91 Å

PDB Description: crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2y78a1:

Sequence; same for both SEQRES and ATOM records:

>d2y78a1 d.26.1.0 (A:1-113) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
mtvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafvlggg
mvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevelldv

Timeline for d2y78a1:

• d2y78a1 first appeared in SCOPe 2.03, called d2y78a_
  
• d2y78a1 appears in SCOPe 2.06
  
• d2y78a1 appears in the current release, SCOPe 2.08