SCOPe 2.05: Domain d2y78a_: 2y78 A:

Lineage for d2y78a_ (2y78 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (23 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:272560] [226139] (3 PDB entries)

8. Domain d2y78a_: 2y78 A: [207492]
   automated match to d4dz3b_
   complexed with cl, gol, so4

Details for d2y78a_

PDB Entry: 2y78, 0.91 Å

PDB Description: crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2y78a_:

Sequence; same for both SEQRES and ATOM records:

>d2y78a_ d.26.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
sglvprgshmtvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrnd
pfafvlgggmvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevell
dv

Timeline for d2y78a_:

• d2y78a_ first appeared in SCOPe 2.03
  
• d2y78a_ appears in SCOPe 2.04
  
• d2y78a_ is called d2y78a1 in SCOPe 2.06
  
• d2y78a_ appears in the current release, SCOPe 2.08, called d2y78a1