Lineage for d2y5za_ (2y5z A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278119Species Micromonospora griseorubida [TaxId:28040] [226290] (8 PDB entries)
  8. 1278130Domain d2y5za_: 2y5z A: [207483]
    automated match to d3e5la_
    complexed with ben, gol, hem, zm3

Details for d2y5za_

PDB Entry: 2y5z (more details), 2.06 Å

PDB Description: mixed-function p450 mycg in complex with mycinamicin iii in c2221 space group
PDB Compounds: (A:) p-450-like protein

SCOPe Domain Sequences for d2y5za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y5za_ a.104.1.0 (A:) automated matches {Micromonospora griseorubida [TaxId: 28040]}
epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
qrlpgirlgipetqlrwsegmllrgplelpvvw

SCOPe Domain Coordinates for d2y5za_:

Click to download the PDB-style file with coordinates for d2y5za_.
(The format of our PDB-style files is described here.)

Timeline for d2y5za_: