Lineage for d2y5nb1 (2y5n B:1-397)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005702Species Micromonospora griseorubida [TaxId:28040] [226290] (10 PDB entries)
  8. 2005704Domain d2y5nb1: 2y5n B:1-397 [207482]
    Other proteins in same PDB: d2y5nb2
    automated match to d3e5la_
    complexed with gol, hem, mg, myv

Details for d2y5nb1

PDB Entry: 2y5n (more details), 1.62 Å

PDB Description: Structure of the mixed-function P450 MycG in complex with mycinamicin V in P21 space group
PDB Compounds: (B:) p-450-like protein

SCOPe Domain Sequences for d2y5nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y5nb1 a.104.1.0 (B:1-397) automated matches {Micromonospora griseorubida [TaxId: 28040]}
mtsaepraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgr
fvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahe
lvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemq
eaaeqayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestt
tqiadfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvt
iragepvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqval
evllqrlpgirlgipetqlrwsegmllrgplelpvvw

SCOPe Domain Coordinates for d2y5nb1:

Click to download the PDB-style file with coordinates for d2y5nb1.
(The format of our PDB-style files is described here.)

Timeline for d2y5nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2y5nb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2y5na_