Class a: All alpha proteins [46456] (286 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (45 species) not a true protein |
Species Micromonospora griseorubida [TaxId:28040] [226290] (8 PDB entries) |
Domain d2y5na_: 2y5n A: [207481] automated match to d3e5la_ complexed with gol, hem, mg, myv |
PDB Entry: 2y5n (more details), 1.62 Å
SCOPe Domain Sequences for d2y5na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y5na_ a.104.1.0 (A:) automated matches {Micromonospora griseorubida [TaxId: 28040]} aepraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvr gpsmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvd qmaatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaa eqayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqi adfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtira gepvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevl lqrlpgirlgipetqlrwsegmllrgplelpvvw
Timeline for d2y5na_: