SCOPe 2.03: Domain d2y55c_: 2y55 C:

Lineage for d2y55c_ (2y55 C:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.3: Dac-like [144040] (3 proteins)
   Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology

6. Protein D-alanyl-D-alanine carboxypeptidase Dac [144043] (1 species)

7. Species Actinomadura sp. [TaxId:1989] [144044] (16 PDB entries)
   Uniprot P39045 50-516

8. Domain d2y55c_: 2y55 C: [207475]
   automated match to d2wked_
   complexed with acn, fp5, mg, so4

Details for d2y55c_

PDB Entry: 2y55, 2.6 Å

PDB Description: unexpected tricovalent binding mode of boronic acids within the active site of a penicillin binding protein

PDB Compounds: (C:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d2y55c_:

Sequence; same for both SEQRES and ATOM records:

>d2y55c_ e.3.1.3 (C:) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]}
rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqape

Timeline for d2y55c_:

• d2y55c_ is new in SCOPe 2.03-stable
  
• d2y55c_ appears in SCOPe 2.04
  
• d2y55c_ appears in the current release, SCOPe 2.08