Lineage for d1agba1 (1agb A:182-276)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 53033Species Human (Homo sapiens), HLA-B0801 [TaxId:9606] [48951] (5 PDB entries)
  8. 53040Domain d1agba1: 1agb A:182-276 [20747]
    Other proteins in same PDB: d1agba2

Details for d1agba1

PDB Entry: 1agb (more details), 2.2 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggrkkykl-3r mutation)
PDB Compounds: (A:)

SCOP Domain Sequences for d1agba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agba1 b.1.1.2 (A:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B0801}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1agba1:

Click to download the PDB-style file with coordinates for d1agba1.
(The format of our PDB-style files is described here.)

Timeline for d1agba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agba2
View in 3D
Domains from other chains:
(mouse over for more information)
d1agbb1