SCOPe 2.04: Domain d2y3yb_: 2y3y B:

Lineage for d2y3yb_ (2y3y B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.0: automated matches [227175] (1 protein)
   not a true family

6. Protein automated matches [226892] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:563041] [226192] (2 PDB entries)

8. Domain d2y3yb_: 2y3y B: [207463]
   automated match to d1q5ya_
   complexed with epe, ni, peg

Details for d2y3yb_

PDB Entry: 2y3y, 2.39 Å

PDB Description: holo-ni(ii) hpnikr is a symmetric tetramer containing four canonic square-planar ni(ii) ions at physiological ph

PDB Compounds: (B:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2y3yb_:

Sequence; same for both SEQRES and ATOM records:

>d2y3yb_ d.58.18.0 (B:) automated matches {Helicobacter pylori [TaxId: 563041]}
ndeskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfe
iqrlqleigglrgvkfakltkas

Timeline for d2y3yb_:

• d2y3yb_ first appeared in SCOPe 2.03
  
• d2y3yb_ appears in SCOPe 2.05
  
• d2y3yb_ appears in the current release, SCOPe 2.08