| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.0: automated matches [227175] (1 protein) not a true family |
| Protein automated matches [226892] (5 species) not a true protein |
| Species Helicobacter pylori [TaxId:563041] [226192] (2 PDB entries) |
| Domain d2y3ya_: 2y3y A: [207462] automated match to d1q5ya_ complexed with epe, ni, peg |
PDB Entry: 2y3y (more details), 2.39 Å
SCOPe Domain Sequences for d2y3ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y3ya_ d.58.18.0 (A:) automated matches {Helicobacter pylori [TaxId: 563041]}
ndeskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfe
iqrlqleigglrgvkfakltkas
Timeline for d2y3ya_: