Lineage for d2y3ya_ (2y3y A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197025Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2197238Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 2197239Protein automated matches [226892] (5 species)
    not a true protein
  7. 2197248Species Helicobacter pylori [TaxId:563041] [226192] (2 PDB entries)
  8. 2197249Domain d2y3ya_: 2y3y A: [207462]
    automated match to d1q5ya_
    complexed with epe, ni, peg

Details for d2y3ya_

PDB Entry: 2y3y (more details), 2.39 Å

PDB Description: holo-ni(ii) hpnikr is a symmetric tetramer containing four canonic square-planar ni(ii) ions at physiological ph
PDB Compounds: (A:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2y3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y3ya_ d.58.18.0 (A:) automated matches {Helicobacter pylori [TaxId: 563041]}
ndeskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfe
iqrlqleigglrgvkfakltkas

SCOPe Domain Coordinates for d2y3ya_:

Click to download the PDB-style file with coordinates for d2y3ya_.
(The format of our PDB-style files is described here.)

Timeline for d2y3ya_: