Lineage for d2y2fa_ (2y2f A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483190Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2483195Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species)
  7. 2483200Species Yersinia enterocolitica [TaxId:630] [52812] (20 PDB entries)
  8. 2483206Domain d2y2fa_: 2y2f A: [207459]
    automated match to d1qz0a_
    complexed with yi1

Details for d2y2fa_

PDB Entry: 2y2f (more details), 1.78 Å

PDB Description: crystal structure of yersinia pestis yoph in complex with an aminooxy-containing platform compound for inhibitor design
PDB Compounds: (A:) protein-tyrosine phosphatase yoph

SCOPe Domain Sequences for d2y2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y2fa_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOPe Domain Coordinates for d2y2fa_:

Click to download the PDB-style file with coordinates for d2y2fa_.
(The format of our PDB-style files is described here.)

Timeline for d2y2fa_: