SCOPe 2.03: Domain d2y2fa_: 2y2f A:

Lineage for d2y2fa_ (2y2f A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species)

7. Species Yersinia enterocolitica [TaxId:630] [52812] (15 PDB entries)

8. Domain d2y2fa_: 2y2f A: [207459]
   automated match to d1qz0a_
   complexed with yi1

Details for d2y2fa_

PDB Entry: 2y2f, 1.78 Å

PDB Description: crystal structure of yersinia pestis yoph in complex with an aminooxy-containing platform compound for inhibitor design

PDB Compounds: (A:) protein-tyrosine phosphatase yoph

SCOPe Domain Sequences for d2y2fa_:

Sequence; same for both SEQRES and ATOM records:

>d2y2fa_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

Timeline for d2y2fa_:

• d2y2fa_ is new in SCOPe 2.03-stable
  
• d2y2fa_ appears in SCOPe 2.04
  
• d2y2fa_ appears in the current release, SCOPe 2.08