![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
![]() | Protein Glycosyl hydrolase family 5 xylanase [101922] (1 species) |
![]() | Species Erwinia chrysanthemi [TaxId:556] [101923] (2 PDB entries) |
![]() | Domain d2y24a1: 2y24 A:31-43,A:321-413 [207457] Other proteins in same PDB: d2y24a2 automated match to d1nofa1 complexed with imd, pg4, pge |
PDB Entry: 2y24 (more details), 1.39 Å
SCOPe Domain Sequences for d2y24a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y24a1 b.71.1.2 (A:31-43,A:321-413) Glycosyl hydrolase family 5 xylanase {Erwinia chrysanthemi [TaxId: 556]} dtvkidanvnyqiXgalriqatenpqsnvhltaykntdgkmvivavntndsdqmlslnis nanvtkfekystsaslnveyggssqvdssgkatvwlnplsvttfvsk
Timeline for d2y24a1: