SCOPe 2.06: Domain d2y1ta_: 2y1t A:

Lineage for d2y1ta_ (2y1t A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (16 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries)

8. Domain d2y1ta_: 2y1t A: [207451]
   automated match to d2bazc_
   complexed with dud

Details for d2y1ta_

PDB Entry: 2y1t, 1.89 Å

PDB Description: bacillus subtilis prophage dutpase in complex with dudp

PDB Compounds: (A:) spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss

SCOPe Domain Sequences for d2y1ta_:

Sequence; same for both SEQRES and ATOM records:

>d2y1ta_ b.85.4.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
dlievdrl

Timeline for d2y1ta_:

• d2y1ta_ first appeared in SCOPe 2.03
  
• d2y1ta_ appears in SCOPe 2.05
  
• d2y1ta_ appears in SCOPe 2.07
  
• d2y1ta_ appears in the current release, SCOPe 2.08