SCOP 1.57: Domain d1agfa1: 1agf A:182-276

Lineage for d1agfa1 (1agf A:182-276)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-B0801 [TaxId:9606] [48951] (5 PDB entries)

8. Domain d1agfa1: 1agf A:182-276 [20745]
   Other proteins in same PDB: d1agfa2

Details for d1agfa1

PDB Entry: 1agf, 2.2 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkrykl-5r mutation)

SCOP Domain Sequences for d1agfa1:

Sequence; same for both SEQRES and ATOM records:

>d1agfa1 b.1.1.2 (A:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B0801}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d1agfa1:

• d1agfa1 first appeared (with stable ids) in SCOP 1.55
  
• d1agfa1 appears in SCOP 1.59
  
• d1agfa1 appears in the current release, SCOPe 2.08