Lineage for d2xzal1 (2xza L:1-109)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519232Domain d2xzal1: 2xza L:1-109 [207441]
    Other proteins in same PDB: d2xzal2
    automated match to d1rhha1

Details for d2xzal1

PDB Entry: 2xza (more details), 1.5 Å

PDB Description: crystal structure of recombinant a.17 antibody fab fragment
PDB Compounds: (L:) fab a.17 light chain

SCOPe Domain Sequences for d2xzal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzal1 b.1.1.0 (L:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
drfsgsksgtsatlgitglqtgdeadyycgtwdsslnpvfgggtkleik

SCOPe Domain Coordinates for d2xzal1:

Click to download the PDB-style file with coordinates for d2xzal1.
(The format of our PDB-style files is described here.)

Timeline for d2xzal1: